ARL6IP MaxPab mouse polyclonal antibody (B02) View larger

ARL6IP MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ARL6IP MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00023204-B02
Product name: ARL6IP MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human ARL6IP protein.
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Genbank accession: NM_015161.1
Immunogen: ARL6IP (NP_055976.1, 1 a.a. ~ 203 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Protein accession: NP_055976.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023204-B02-13-15-1.jpg
Application image note: Western Blot analysis of ARL6IP1 expression in transfected 293T cell line (H00023204-T02) by ARL6IP1 MaxPab polyclonal antibody.

Lane 1: ARL6IP transfected lysate(22.33 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARL6IP MaxPab mouse polyclonal antibody (B02) now

Add to cart