ATP11B polyclonal antibody (A01) View larger

ATP11B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP11B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATP11B polyclonal antibody (A01)

Brand: Abnova
Reference: H00023200-A01
Product name: ATP11B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ATP11B.
Gene id: 23200
Gene name: ATP11B
Gene alias: ATPIF|ATPIR|DKFZp434J238|DKFZp434N1615|KIAA0956|MGC46576
Gene description: ATPase, class VI, type 11B
Genbank accession: NM_014616
Immunogen: ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Protein accession: NP_055431
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023200-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP11B polyclonal antibody (A01) now

Add to cart