Brand: | Abnova |
Reference: | H00023178-M02A |
Product name: | PASK monoclonal antibody (M02A), clone 6B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PASK. |
Clone: | 6B7 |
Isotype: | IgM Kappa |
Gene id: | 23178 |
Gene name: | PASK |
Gene alias: | DKFZp434O051|DKFZp686P2031|KIAA0135|PASKIN|STK37 |
Gene description: | PAS domain containing serine/threonine kinase |
Genbank accession: | BC063585 |
Immunogen: | PASK (AAH63585, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE |
Protein accession: | AAH63585 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |