PASK monoclonal antibody (M01), clone 6D10 View larger

PASK monoclonal antibody (M01), clone 6D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PASK monoclonal antibody (M01), clone 6D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PASK monoclonal antibody (M01), clone 6D10

Brand: Abnova
Reference: H00023178-M01
Product name: PASK monoclonal antibody (M01), clone 6D10
Product description: Mouse monoclonal antibody raised against a partial recombinant PASK.
Clone: 6D10
Isotype: IgG1 Kappa
Gene id: 23178
Gene name: PASK
Gene alias: DKFZp434O051|DKFZp686P2031|KIAA0135|PASKIN|STK37
Gene description: PAS domain containing serine/threonine kinase
Genbank accession: BC063585
Immunogen: PASK (AAH63585, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE
Protein accession: AAH63585
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023178-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023178-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PASK is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PASK monoclonal antibody (M01), clone 6D10 now

Add to cart