SEPT8 monoclonal antibody (M08), clone 3G1 View larger

SEPT8 monoclonal antibody (M08), clone 3G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT8 monoclonal antibody (M08), clone 3G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,ELISA,WB-Re

More info about SEPT8 monoclonal antibody (M08), clone 3G1

Brand: Abnova
Reference: H00023176-M08
Product name: SEPT8 monoclonal antibody (M08), clone 3G1
Product description: Mouse monoclonal antibody raised against a full-length recombinant SEPT8.
Clone: 3G1
Isotype: IgG2a Kappa
Gene id: 23176
Gene name: SEPT8
Gene alias: KIAA0202|SEP2
Gene description: septin 8
Genbank accession: BC001329
Immunogen: SEPT8 (AAH01329, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN
Protein accession: AAH01329
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023176-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023176-M08-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SEPT8 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEPT8 monoclonal antibody (M08), clone 3G1 now

Add to cart