Brand: | Abnova |
Reference: | H00023139-M01 |
Product name: | MAST2 monoclonal antibody (M01), clone 3F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAST2. |
Clone: | 3F9 |
Isotype: | IgG2b Kappa |
Gene id: | 23139 |
Gene name: | MAST2 |
Gene alias: | FLJ39200|KIAA0807|MAST205|MTSSK|RP4-533D7.1 |
Gene description: | microtubule associated serine/threonine kinase 2 |
Genbank accession: | BC015816 |
Immunogen: | MAST2 (AAH15816, 688 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSRDSSPRSMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPVRQGFVKVTSSPMSMGNLCMAWCTRRWWS |
Protein accession: | AAH15816 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAST2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |