CDC2L6 monoclonal antibody (M06), clone 8B6 View larger

CDC2L6 monoclonal antibody (M06), clone 8B6

H00023097-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC2L6 monoclonal antibody (M06), clone 8B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about CDC2L6 monoclonal antibody (M06), clone 8B6

Brand: Abnova
Reference: H00023097-M06
Product name: CDC2L6 monoclonal antibody (M06), clone 8B6
Product description: Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
Clone: 8B6
Isotype: IgG2a Kappa
Gene id: 23097
Gene name: CDC2L6
Gene alias: CDK11|KIAA1028|bA346C16.3
Gene description: cell division cycle 2-like 6 (CDK8-like)
Genbank accession: BC037289
Immunogen: CDC2L6 (AAH37289, 367 a.a. ~ 467 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNY
Protein accession: AAH37289
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023097-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023097-M06-13-15-1.jpg
Application image note: Western Blot analysis of CDC2L6 expression in transfected 293T cell line by CDC2L6 monoclonal antibody (M06), clone 8B6.

Lane 1: CDC2L6 transfected lysate (Predicted MW: 56.8 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC2L6 monoclonal antibody (M06), clone 8B6 now

Add to cart