H00023097-M06_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00023097-M06 |
Product name: | CDC2L6 monoclonal antibody (M06), clone 8B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L6. |
Clone: | 8B6 |
Isotype: | IgG2a Kappa |
Gene id: | 23097 |
Gene name: | CDC2L6 |
Gene alias: | CDK11|KIAA1028|bA346C16.3 |
Gene description: | cell division cycle 2-like 6 (CDK8-like) |
Genbank accession: | BC037289 |
Immunogen: | CDC2L6 (AAH37289, 367 a.a. ~ 467 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNY |
Protein accession: | AAH37289 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CDC2L6 expression in transfected 293T cell line by CDC2L6 monoclonal antibody (M06), clone 8B6. Lane 1: CDC2L6 transfected lysate (Predicted MW: 56.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |