CDC2L6 monoclonal antibody (M02), clone 2F11 View larger

CDC2L6 monoclonal antibody (M02), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC2L6 monoclonal antibody (M02), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA

More info about CDC2L6 monoclonal antibody (M02), clone 2F11

Brand: Abnova
Reference: H00023097-M02
Product name: CDC2L6 monoclonal antibody (M02), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
Clone: 2F11
Isotype: IgG2a Kappa
Gene id: 23097
Gene name: CDC2L6
Gene alias: CDK11|KIAA1028|bA346C16.3
Gene description: cell division cycle 2-like 6 (CDK8-like)
Genbank accession: NM_015076
Immunogen: CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Protein accession: NP_055891.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023097-M02-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDC2L6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA
Shipping condition: Dry Ice

Reviews

Buy CDC2L6 monoclonal antibody (M02), clone 2F11 now

Add to cart