Brand: | Abnova |
Reference: | H00023097-M02 |
Product name: | CDC2L6 monoclonal antibody (M02), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L6. |
Clone: | 2F11 |
Isotype: | IgG2a Kappa |
Gene id: | 23097 |
Gene name: | CDC2L6 |
Gene alias: | CDK11|KIAA1028|bA346C16.3 |
Gene description: | cell division cycle 2-like 6 (CDK8-like) |
Genbank accession: | NM_015076 |
Immunogen: | CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS |
Protein accession: | NP_055891.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CDC2L6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA |
Shipping condition: | Dry Ice |