Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SWAP70 monoclonal antibody (M09A), clone 3H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
More info about SWAP70 monoclonal antibody (M09A), clone 3H8
| Brand: | Abnova |
| Reference: | H00023075-M09A |
| Product name: | SWAP70 monoclonal antibody (M09A), clone 3H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SWAP70. |
| Clone: | 3H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23075 |
| Gene name: | SWAP70 |
| Gene alias: | FLJ39540|HSPC321|KIAA0640|SWAP-70 |
| Gene description: | SWAP-70 protein |
| Genbank accession: | NM_015055 |
| Immunogen: | SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA |
| Protein accession: | NP_055870 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in NIH/3T3(Cat # L018V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | SWAP-70 contributes to spontaneous transformation of mouse embryo fibroblasts.Chang YT, Shu CL, Lai JY, Ching-Yu L, Chuu CP, Morishita K, Ichikawa T, Jessberger R, Fukui Y. Exp Cell Res. 2015 Jun 20. [Epub ahead of print] |