Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NMNAT2 monoclonal antibody (M02), clone 4E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about NMNAT2 monoclonal antibody (M02), clone 4E6
| Brand: | Abnova |
| Reference: | H00023057-M02 |
| Product name: | NMNAT2 monoclonal antibody (M02), clone 4E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NMNAT2. |
| Clone: | 4E6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23057 |
| Gene name: | NMNAT2 |
| Gene alias: | C1orf15|KIAA0479|MGC2756|PNAT-2|PNAT2 |
| Gene description: | nicotinamide nucleotide adenylyltransferase 2 |
| Genbank accession: | NM_015039 |
| Immunogen: | NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG |
| Protein accession: | NP_055854 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NMNAT2 monoclonal antibody (M02), clone 4E6. Western Blot analysis of NMNAT2 expression in MCF-7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Nmnat2 delays axon degeneration in superior cervical ganglia dependent on its NAD synthesis activity.Yan T, Feng Y, Zheng J, Ge X, Zhang Y, Wu D, Zhao J, Zhai Q. Neurochem Int. 2009 Sep 22. [Epub ahead of print] |