Brand: | Abnova |
Reference: | H00023057-M01 |
Product name: | NMNAT2 monoclonal antibody (M01), clone 2E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NMNAT2. |
Clone: | 2E4 |
Isotype: | IgG1 Kappa |
Gene id: | 23057 |
Gene name: | NMNAT2 |
Gene alias: | C1orf15|KIAA0479|MGC2756|PNAT-2|PNAT2 |
Gene description: | nicotinamide nucleotide adenylyltransferase 2 |
Genbank accession: | NM_015039 |
Immunogen: | NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG |
Protein accession: | NP_055854 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NMNAT2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |