Brand: | Abnova |
Reference: | H00023049-M01 |
Product name: | SMG1 monoclonal antibody (M01), clone 1G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMG1. |
Clone: | 1G5 |
Isotype: | IgG1 Kappa |
Gene id: | 23049 |
Gene name: | SMG1 |
Gene alias: | 61E3.4|ATX|KIAA0421|LIP |
Gene description: | SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans) |
Genbank accession: | NM_014006 |
Immunogen: | SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV |
Protein accession: | NP_055535 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SMG1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |