SMG1 monoclonal antibody (M01), clone 1G5 View larger

SMG1 monoclonal antibody (M01), clone 1G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMG1 monoclonal antibody (M01), clone 1G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SMG1 monoclonal antibody (M01), clone 1G5

Brand: Abnova
Reference: H00023049-M01
Product name: SMG1 monoclonal antibody (M01), clone 1G5
Product description: Mouse monoclonal antibody raised against a partial recombinant SMG1.
Clone: 1G5
Isotype: IgG1 Kappa
Gene id: 23049
Gene name: SMG1
Gene alias: 61E3.4|ATX|KIAA0421|LIP
Gene description: SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
Genbank accession: NM_014006
Immunogen: SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Protein accession: NP_055535
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023049-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023049-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SMG1 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMG1 monoclonal antibody (M01), clone 1G5 now

Add to cart