TNIK monoclonal antibody (M01), clone 2D2 View larger

TNIK monoclonal antibody (M01), clone 2D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNIK monoclonal antibody (M01), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TNIK monoclonal antibody (M01), clone 2D2

Brand: Abnova
Reference: H00023043-M01
Product name: TNIK monoclonal antibody (M01), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant TNIK.
Clone: 2D2
Isotype: IgG1 Kappa
Gene id: 23043
Gene name: TNIK
Gene alias: -
Gene description: TRAF2 and NCK interacting kinase
Genbank accession: BC055427
Immunogen: TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL
Protein accession: AAH55427
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023043-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023043-M01-13-15-1.jpg
Application image note: Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2.

Lane 1: TNIK transfected lysate(60.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNIK monoclonal antibody (M01), clone 2D2 now

Add to cart