Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00023043-M01 |
Product name: | TNIK monoclonal antibody (M01), clone 2D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNIK. |
Clone: | 2D2 |
Isotype: | IgG1 Kappa |
Gene id: | 23043 |
Gene name: | TNIK |
Gene alias: | - |
Gene description: | TRAF2 and NCK interacting kinase |
Genbank accession: | BC055427 |
Immunogen: | TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL |
Protein accession: | AAH55427 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2. Lane 1: TNIK transfected lysate(60.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |