Brand: | Abnova |
Reference: | H00023032-M01 |
Product name: | USP33 monoclonal antibody (M01), clone 5B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP33. |
Clone: | 5B5 |
Isotype: | IgG1 Kappa |
Gene id: | 23032 |
Gene name: | USP33 |
Gene alias: | KIAA1097|MGC16868|VDU1 |
Gene description: | ubiquitin specific peptidase 33 |
Genbank accession: | NM_015017 |
Immunogen: | USP33 (NP_055832, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL |
Protein accession: | NP_055832 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to USP33 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |