FAIM2 monoclonal antibody (M10), clone 2C2 View larger

FAIM2 monoclonal antibody (M10), clone 2C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAIM2 monoclonal antibody (M10), clone 2C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about FAIM2 monoclonal antibody (M10), clone 2C2

Brand: Abnova
Reference: H00023017-M10
Product name: FAIM2 monoclonal antibody (M10), clone 2C2
Product description: Mouse monoclonal antibody raised against a full-length recombinant FAIM2.
Clone: 2C2
Isotype: IgG2a Kappa
Gene id: 23017
Gene name: FAIM2
Gene alias: KIAA0950|LFG|NGP35|NMP35|TMBIM2
Gene description: Fas apoptotic inhibitory molecule 2
Genbank accession: BC000051
Immunogen: FAIM2 (AAH00051, 1 a.a. ~ 316 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
Protein accession: AAH00051
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023017-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (60.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023017-M10-13-15-1.jpg
Application image note: Western Blot analysis of FAIM2 expression in transfected 293T cell line by FAIM2 monoclonal antibody (M10), clone 2C2.

Lane 1: FAIM2 transfected lysate(35.1 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FAIM2 monoclonal antibody (M10), clone 2C2 now

Add to cart