SCMH1 monoclonal antibody (M02), clone 1H2 View larger

SCMH1 monoclonal antibody (M02), clone 1H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCMH1 monoclonal antibody (M02), clone 1H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SCMH1 monoclonal antibody (M02), clone 1H2

Brand: Abnova
Reference: H00022955-M02
Product name: SCMH1 monoclonal antibody (M02), clone 1H2
Product description: Mouse monoclonal antibody raised against a partial recombinant SCMH1.
Clone: 1H2
Isotype: IgG2a Kappa
Gene id: 22955
Gene name: SCMH1
Gene alias: Scml3
Gene description: sex comb on midleg homolog 1 (Drosophila)
Genbank accession: NM_012236
Immunogen: SCMH1 (NP_036368, 404 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR
Protein accession: NP_036368
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00022955-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022955-M02-1-12-1.jpg
Application image note: SCMH1 monoclonal antibody (M02), clone 1H2 Western Blot analysis of SCMH1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCMH1 monoclonal antibody (M02), clone 1H2 now

Add to cart