Brand: | Abnova |
Reference: | H00022950-A01 |
Product name: | SLC4A1AP polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC4A1AP. |
Gene id: | 22950 |
Gene name: | SLC4A1AP |
Gene alias: | FLJ10624|FLJ41004|HLC3|MGC120646|MGC120648 |
Gene description: | solute carrier family 4 (anion exchanger), member 1, adaptor protein |
Genbank accession: | NM_018158 |
Immunogen: | SLC4A1AP (NP_060628, 154 a.a. ~ 254 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTY |
Protein accession: | NP_060628 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |