Brand: | Abnova |
Reference: | H00022943-M08 |
Product name: | DKK1 monoclonal antibody (M08), clone 2B12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant DKK1. |
Clone: | 2B12 |
Isotype: | IgG2b Kappa |
Gene id: | 22943 |
Gene name: | DKK1 |
Gene alias: | DKK-1|SK |
Gene description: | dickkopf homolog 1 (Xenopus laevis) |
Genbank accession: | BC001539 |
Immunogen: | DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Protein accession: | AAH01539.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |
Publications: | High dickkopf-1 levels in sera and leukocytes from children with 21-hydroxylase deficiency on chronic glucocorticoid treatment.Brunetti G, Faienza MF, Piacente L, Ventura A, Oranger A, Carbone C, Benedetto AD, Colaianni G, Gigante M, Mori G, Gesualdo L, Colucci S, Cavallo L, Grano M Am J Physiol Endocrinol Metab. 2013 Mar;304(5):E546-54. doi: 10.1152/ajpendo.00535.2012. Epub 2013 Jan 8. |