DKK1 monoclonal antibody (M04), clone 3D9 View larger

DKK1 monoclonal antibody (M04), clone 3D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DKK1 monoclonal antibody (M04), clone 3D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about DKK1 monoclonal antibody (M04), clone 3D9

Brand: Abnova
Reference: H00022943-M04
Product name: DKK1 monoclonal antibody (M04), clone 3D9
Product description: Mouse monoclonal antibody raised against a partial recombinant DKK1.
Clone: 3D9
Isotype: IgG2b Kappa
Gene id: 22943
Gene name: DKK1
Gene alias: DKK-1|SK
Gene description: dickkopf homolog 1 (Xenopus laevis)
Genbank accession: NM_012242
Immunogen: DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
Protein accession: NP_036374
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022943-M04-1-1-1.jpg
Application image note: DKK1 monoclonal antibody (M04), clone 3D9 Western Blot analysis of DKK1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy DKK1 monoclonal antibody (M04), clone 3D9 now

Add to cart