Brand: | Abnova |
Reference: | H00022943-M01 |
Product name: | DKK1 monoclonal antibody (M01), clone 4D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DKK1. |
Clone: | 4D4 |
Isotype: | IgG2b Kappa |
Gene id: | 22943 |
Gene name: | DKK1 |
Gene alias: | DKK-1|SK |
Gene description: | dickkopf homolog 1 (Xenopus laevis) |
Genbank accession: | NM_012242 |
Immunogen: | DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH |
Protein accession: | NP_036374 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DKK1 monoclonal antibody (M01), clone 4D4 Western Blot analysis of DKK1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A Succinate Ether Derivative of Tocotrienol Enhances Dickkopf-1 Gene Expression through Epigenetic Alterations in Malignant Mesothelioma Cells.Sato A, Ueno H, Fusegi M, Kaneko S, Kohno K, Virgona N, Ando A, Sekine Y, Yano T. Pharmacology. 2018 May 15;102(1-2):26-36. |