Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DKK1 monoclonal antibody (M01), clone 4D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about DKK1 monoclonal antibody (M01), clone 4D4
| Brand: | Abnova |
| Reference: | H00022943-M01 |
| Product name: | DKK1 monoclonal antibody (M01), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DKK1. |
| Clone: | 4D4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 22943 |
| Gene name: | DKK1 |
| Gene alias: | DKK-1|SK |
| Gene description: | dickkopf homolog 1 (Xenopus laevis) |
| Genbank accession: | NM_012242 |
| Immunogen: | DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH |
| Protein accession: | NP_036374 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DKK1 monoclonal antibody (M01), clone 4D4 Western Blot analysis of DKK1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Succinate Ether Derivative of Tocotrienol Enhances Dickkopf-1 Gene Expression through Epigenetic Alterations in Malignant Mesothelioma Cells.Sato A, Ueno H, Fusegi M, Kaneko S, Kohno K, Virgona N, Ando A, Sekine Y, Yano T. Pharmacology. 2018 May 15;102(1-2):26-36. |