RPIA purified MaxPab rabbit polyclonal antibody (D01P) View larger

RPIA purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPIA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about RPIA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00022934-D01P
Product name: RPIA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RPIA protein.
Gene id: 22934
Gene name: RPIA
Gene alias: RPI
Gene description: ribose 5-phosphate isomerase A
Genbank accession: BC015529.1
Immunogen: RPIA (ENSP00000283646, 1 a.a. ~ 237 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC
Protein accession: ENSP00000283646
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00022934-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RPIA expression in transfected 293T cell line (H00022934-T03) by RPIA MaxPab polyclonal antibody.

Lane 1: RPIA transfected lysate(26.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RPIA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart