RAB18 monoclonal antibody (M03), clone 4C8 View larger

RAB18 monoclonal antibody (M03), clone 4C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB18 monoclonal antibody (M03), clone 4C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RAB18 monoclonal antibody (M03), clone 4C8

Brand: Abnova
Reference: H00022931-M03
Product name: RAB18 monoclonal antibody (M03), clone 4C8
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB18.
Clone: 4C8
Isotype: IgG2a Kappa
Gene id: 22931
Gene name: RAB18
Gene alias: RAB18LI1
Gene description: RAB18, member RAS oncogene family
Genbank accession: BC015014
Immunogen: RAB18 (AAH15014, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYC
Protein accession: AAH15014
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022931-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB18 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RAB18 monoclonal antibody (M03), clone 4C8 now

Add to cart