Brand: | Abnova |
Reference: | H00022926-M03 |
Product name: | ATF6 monoclonal antibody (M03), clone 3D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATF6. |
Clone: | 3D5 |
Isotype: | IgG2a Kappa |
Gene id: | 22926 |
Gene name: | ATF6 |
Gene alias: | ATF6A |
Gene description: | activating transcription factor 6 |
Genbank accession: | BC014969 |
Immunogen: | ATF6 (AAH14969.1, 91 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQ |
Protein accession: | AAH14969.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ATF6 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |