Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSRB2 monoclonal antibody (M01), clone 2B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MSRB2 monoclonal antibody (M01), clone 2B7
| Brand: | Abnova |
| Reference: | H00022921-M01 |
| Product name: | MSRB2 monoclonal antibody (M01), clone 2B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MSRB2. |
| Clone: | 2B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 22921 |
| Gene name: | MSRB2 |
| Gene alias: | CBS-1|CBS1|CGI-131|MGC26104|MSRB|PILB |
| Gene description: | methionine sulfoxide reductase B2 |
| Genbank accession: | NM_012228 |
| Immunogen: | MSRB2 (NP_036360, 102 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH |
| Protein accession: | NP_036360 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MSRB2 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Methionine sulfoxide reductase B2 is highly expressed in the retina and protects retinal pigmented epithelium cells from oxidative damage.Pascual I, Larrayoz IM, Campos MM, Rodriguez IR. Exp Eye Res. 2009 Dec 22. [Epub ahead of print] |