NCBP2 monoclonal antibody (M02), clone 3A12 View larger

NCBP2 monoclonal antibody (M02), clone 3A12

H00022916-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCBP2 monoclonal antibody (M02), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NCBP2 monoclonal antibody (M02), clone 3A12

Brand: Abnova
Reference: H00022916-M02
Product name: NCBP2 monoclonal antibody (M02), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant NCBP2.
Clone: 3A12
Isotype: IgG1 Kappa
Gene id: 22916
Gene name: NCBP2
Gene alias: CBC2|CBP20|NIP1|PIG55
Gene description: nuclear cap binding protein subunit 2, 20kDa
Genbank accession: NM_007362
Immunogen: NCBP2 (NP_031388, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMR
Protein accession: NP_031388
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022916-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NCBP2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NCBP2 monoclonal antibody (M02), clone 3A12 now

Add to cart