Brand: | Abnova |
Reference: | H00022891-M03 |
Product name: | ZNF365 monoclonal antibody (M03), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF365. |
Clone: | 2E3 |
Isotype: | IgG1 Kappa |
Gene id: | 22891 |
Gene name: | ZNF365 |
Gene alias: | KIAA0844|MGC41821|MGC87345|Su48|UAN|ZNF365D |
Gene description: | zinc finger protein 365 |
Genbank accession: | NM_014951 |
Immunogen: | ZNF365 (NP_055766, 147 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN |
Protein accession: | NP_055766 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF365 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |