Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00022891-B01 |
Product name: | ZNF365 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human ZNF365 protein. |
Gene id: | 22891 |
Gene name: | ZNF365 |
Gene alias: | KIAA0844|MGC41821|MGC87345|Su48|UAN|ZNF365D |
Gene description: | zinc finger protein 365 |
Genbank accession: | BC070073.1 |
Immunogen: | ZNF365 (AAH70073.1, 1 a.a. ~ 276 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII |
Protein accession: | AAH70073.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF365 expression in transfected 293T cell line (H00022891-T01) by ZNF365 MaxPab polyclonal antibody. Lane1:ZNF365 transfected lysate(30.36 KDa). Lane2:Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |