Brand: | Abnova |
Reference: | H00022874-M03 |
Product name: | PLEKHA6 monoclonal antibody (M03), clone 1A4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLEKHA6. |
Clone: | 1A4 |
Isotype: | IgG1 Kappa |
Gene id: | 22874 |
Gene name: | PLEKHA6 |
Gene alias: | KIAA0969|MGC176733|PEPP3 |
Gene description: | pleckstrin homology domain containing, family A member 6 |
Genbank accession: | BC010522 |
Immunogen: | PLEKHA6 (AAH10522.1, 1 a.a. ~ 30 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHPRWAARLPLFISLLERADSVTAAYAKQH |
Protein accession: | AAH10522.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.04 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLEKHA6 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |