NLGN1 monoclonal antibody (M03), clone 1D6 View larger

NLGN1 monoclonal antibody (M03), clone 1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLGN1 monoclonal antibody (M03), clone 1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NLGN1 monoclonal antibody (M03), clone 1D6

Brand: Abnova
Reference: H00022871-M03
Product name: NLGN1 monoclonal antibody (M03), clone 1D6
Product description: Mouse monoclonal antibody raised against a partial recombinant NLGN1.
Clone: 1D6
Isotype: IgG1 Kappa
Gene id: 22871
Gene name: NLGN1
Gene alias: KIAA1070|MGC45115
Gene description: neuroligin 1
Genbank accession: NM_014932
Immunogen: NLGN1 (NP_055747, 578 a.a. ~ 677 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS
Protein accession: NP_055747
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00022871-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022871-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged NLGN1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NLGN1 monoclonal antibody (M03), clone 1D6 now

Add to cart