Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NLGN1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about NLGN1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00022871-A01 |
| Product name: | NLGN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NLGN1. |
| Gene id: | 22871 |
| Gene name: | NLGN1 |
| Gene alias: | KIAA1070|MGC45115 |
| Gene description: | neuroligin 1 |
| Genbank accession: | NM_014932 |
| Immunogen: | NLGN1 (NP_055747, 578 a.a. ~ 677 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS |
| Protein accession: | NP_055747 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of NLGN1 expression in transfected 293T cell line by NLGN1 polyclonal antibody (A01). Lane1:NLGN1 transfected lysate (Predicted MW: 92 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |