KIAA0971 monoclonal antibody (M03), clone 1B11 View larger

KIAA0971 monoclonal antibody (M03), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIAA0971 monoclonal antibody (M03), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about KIAA0971 monoclonal antibody (M03), clone 1B11

Brand: Abnova
Reference: H00022868-M03
Product name: KIAA0971 monoclonal antibody (M03), clone 1B11
Product description: Mouse monoclonal antibody raised against a partial recombinant KIAA0971.
Clone: 1B11
Isotype: IgG2a Kappa
Gene id: 22868
Gene name: FASTKD2
Gene alias: KIAA0971
Gene description: FAST kinase domains 2
Genbank accession: NM_014929
Immunogen: KIAA0971 (NP_055744, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLTTLKPFGSVSVESKMNNKAGSFFWNLRQFSTLVSTSRTMRLCCLGLCKPKIVHSNWNILNNFHNRMQSTDIIRYLFQDAFIFKSDVGFQTKGISTLTA
Protein accession: NP_055744
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy KIAA0971 monoclonal antibody (M03), clone 1B11 now

Add to cart