Brand: | Abnova |
Reference: | H00022858-A01 |
Product name: | ICK polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant ICK. |
Gene id: | 22858 |
Gene name: | ICK |
Gene alias: | KIAA0936|LCK2|MGC46090|MRK |
Gene description: | intestinal cell (MAK-like) kinase |
Genbank accession: | BC035807 |
Immunogen: | ICK (AAH35807, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFHFLVITFISNSE |
Protein accession: | AAH35807 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (58.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | ICK polyclonal antibody (A01), Lot # 051103JC01 Western Blot analysis of ICK expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A Novel Protein Kinase from the Ciliate Euplotes raikovi with Close Structural Identity to the Mammalian Intestinal and Male-Germ Cell Kinases: Characterization and Functional Implications in the Autocrine Pheromone Signaling Loop.Vallesi A, Di Pretoro B, Ballarini P, Apone F, Luporini P. Protist. 2010 Jan 12. [Epub ahead of print] |