LMTK2 polyclonal antibody (A01) View larger

LMTK2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMTK2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LMTK2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00022853-A01
Product name: LMTK2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LMTK2.
Gene id: 22853
Gene name: LMTK2
Gene alias: AATYK2|BREK|KIAA1079|KPI-2|KPI2|LMR2|cprk
Gene description: lemur tyrosine kinase 2
Genbank accession: NM_014916
Immunogen: LMTK2 (NP_055731, 1181 a.a. ~ 1280 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EPAQTGVPQQVHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPDIEGKYLGKLGVSGMLDLSED
Protein accession: NP_055731
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00022853-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LMTK2 polyclonal antibody (A01) now

Add to cart