NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P) View larger

NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00022829-D01P
Product name: NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NLGN4Y protein.
Gene id: 22829
Gene name: NLGN4Y
Gene alias: KIAA0951
Gene description: neuroligin 4, Y-linked
Genbank accession: ENST00000297967
Immunogen: NLGN4Y (ENSP00000297967, 1 a.a. ~ 134 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
Protein accession: ENSP00000297967
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00022829-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NLGN4Y expression in transfected 293T cell line (H00022829-T02) by NLGN4Y MaxPab polyclonal antibody.

Lane 1: NLGN4Y transfected lysate(15.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart