Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00022821-M01C |
Product name: | RASA3 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RASA3. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 22821 |
Gene name: | RASA3 |
Gene alias: | GAP1IP4BP|GAPIII|MGC46517|MGC47588 |
Gene description: | RAS p21 protein activator 3 |
Genbank accession: | BC047242 |
Immunogen: | RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI |
Protein accession: | AAH47242 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RASA3 expression in transfected 293T cell line by RASA3 monoclonal antibody (M01C), clone 1F11. Lane 1: RASA3 transfected lysate (Predicted MW: 95.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |