Brand: | Abnova |
Reference: | H00022821-A01 |
Product name: | RASA3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RASA3. |
Gene id: | 22821 |
Gene name: | RASA3 |
Gene alias: | GAP1IP4BP|GAPIII|MGC46517|MGC47588 |
Gene description: | RAS p21 protein activator 3 |
Genbank accession: | BC047242 |
Immunogen: | RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI |
Protein accession: | AAH47242 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |