Brand: | Abnova |
Reference: | H00022800-M01A |
Product name: | RRAS2 monoclonal antibody (M01A), clone 2D3-4B8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RRAS2. |
Clone: | 2D3-4B8 |
Isotype: | IgG2a Kappa |
Gene id: | 22800 |
Gene name: | RRAS2 |
Gene alias: | TC21 |
Gene description: | related RAS viral (r-ras) oncogene homolog 2 |
Genbank accession: | BC013106 |
Immunogen: | RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
Protein accession: | AAH13106 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | RRAS2 monoclonal antibody (M01A), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |