COG2 monoclonal antibody (M01), clone 3H8 View larger

COG2 monoclonal antibody (M01), clone 3H8

H00022796-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COG2 monoclonal antibody (M01), clone 3H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about COG2 monoclonal antibody (M01), clone 3H8

Brand: Abnova
Reference: H00022796-M01
Product name: COG2 monoclonal antibody (M01), clone 3H8
Product description: Mouse monoclonal antibody raised against a partial recombinant COG2.
Clone: 3H8
Isotype: IgG2b Kappa
Gene id: 22796
Gene name: COG2
Gene alias: LDLC
Gene description: component of oligomeric golgi complex 2
Genbank accession: NM_007357
Immunogen: COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Protein accession: NP_031383
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00022796-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00022796-M01-1-19-1.jpg
Application image note: COG2 monoclonal antibody (M01), clone 3H8. Western Blot analysis of COG2 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COG2 monoclonal antibody (M01), clone 3H8 now

Add to cart