Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTK9L monoclonal antibody (M01), clone 2B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about PTK9L monoclonal antibody (M01), clone 2B5
| Brand: | Abnova |
| Reference: | H00011344-M01 |
| Product name: | PTK9L monoclonal antibody (M01), clone 2B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK9L. |
| Clone: | 2B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11344 |
| Gene name: | TWF2 |
| Gene alias: | A6RP|A6r|MSTP011|PTK9L |
| Gene description: | twinfilin, actin-binding protein, homolog 2 (Drosophila) |
| Genbank accession: | BC000327 |
| Immunogen: | PTK9L (AAH00327, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP |
| Protein accession: | AAH00327 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTK9L monoclonal antibody (M01), clone 2B5. Western Blot analysis of TWF2 expression in human liver. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |