Brand: | Abnova |
Reference: | H00011340-M02 |
Product name: | EXOSC8 monoclonal antibody (M02), clone 4B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EXOSC8. |
Clone: | 4B3 |
Isotype: | IgG2a Kappa |
Gene id: | 11340 |
Gene name: | EXOSC8 |
Gene alias: | CIP3|EAP2|OIP2|RP11-421P11.3|RRP43|Rrp43p|bA421P11.3|p9 |
Gene description: | exosome component 8 |
Genbank accession: | NM_181503 |
Immunogen: | EXOSC8 (NP_852480.1, 177 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK |
Protein accession: | NP_852480.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell . [antibody concentration 15 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |