OIP5 purified MaxPab mouse polyclonal antibody (B01P) View larger

OIP5 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OIP5 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about OIP5 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00011339-B01P
Product name: OIP5 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human OIP5 protein.
Gene id: 11339
Gene name: OIP5
Gene alias: 5730547N13Rik|LINT-25|MIS18beta
Gene description: Opa interacting protein 5
Genbank accession: NM_007280
Immunogen: OIP5 (NP_009211.1, 1 a.a. ~ 229 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Protein accession: NP_009211.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011339-B01P-13-15-1.jpg
Application image note: Western Blot analysis of OIP5 expression in transfected 293T cell line (H00011339-T01) by OIP5 MaxPab polyclonal antibody.

Lane 1: OIP5 transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy OIP5 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart