Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CBX3 (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about CBX3 (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00011335-P01 |
| Product name: | CBX3 (Human) Recombinant Protein (P01) |
| Product description: | Human CBX3 full-length ORF ( AAH00954, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 11335 |
| Gene name: | CBX3 |
| Gene alias: | HECH|HP1-GAMMA|HP1Hs-gamma |
| Gene description: | chromobox homolog 3 (HP1 gamma homolog, Drosophila) |
| Genbank accession: | BC000954 |
| Immunogen sequence/protein sequence: | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Protein accession: | AAH00954 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Heterochromatin protein 1 gamma and IκB kinase alpha interdependence during tumour necrosis factor gene transcription elongation in activated macrophages.Thorne JL, Ouboussad L, Lefevre PF. Nucleic Acids Res. 2012 May 30. |