PHB2 monoclonal antibody (M02), clone 2D3 View larger

PHB2 monoclonal antibody (M02), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHB2 monoclonal antibody (M02), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PHB2 monoclonal antibody (M02), clone 2D3

Brand: Abnova
Reference: H00011331-M02
Product name: PHB2 monoclonal antibody (M02), clone 2D3
Product description: Mouse monoclonal antibody raised against a full-length recombinant PHB2.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 11331
Gene name: PHB2
Gene alias: BAP|BCAP37|Bap37|MGC117268|PNAS-141|REA|p22
Gene description: prohibitin 2
Genbank accession: BC014766
Immunogen: PHB2 (AAH14766, 37 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Protein accession: AAH14766
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011331-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PHB2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PHB2 monoclonal antibody (M02), clone 2D3 now

Add to cart