STK38 monoclonal antibody (M03), clone 6F1 View larger

STK38 monoclonal antibody (M03), clone 6F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STK38 monoclonal antibody (M03), clone 6F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about STK38 monoclonal antibody (M03), clone 6F1

Brand: Abnova
Reference: H00011329-M03
Product name: STK38 monoclonal antibody (M03), clone 6F1
Product description: Mouse monoclonal antibody raised against a partial recombinant STK38.
Clone: 6F1
Isotype: IgG2a Kappa
Gene id: 11329
Gene name: STK38
Gene alias: NDR|NDR1
Gene description: serine/threonine kinase 38
Genbank accession: BC012085
Immunogen: STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Protein accession: AAH12085
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011329-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00011329-M03-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STK38 monoclonal antibody (M03), clone 6F1 now

Add to cart