LYPLA2 monoclonal antibody (M01), clone 3H5 View larger

LYPLA2 monoclonal antibody (M01), clone 3H5

H00011313-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LYPLA2 monoclonal antibody (M01), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about LYPLA2 monoclonal antibody (M01), clone 3H5

Brand: Abnova
Reference: H00011313-M01
Product name: LYPLA2 monoclonal antibody (M01), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant LYPLA2.
Clone: 3H5
Isotype: IgG2b Kappa
Gene id: 11313
Gene name: LYPLA2
Gene alias: APT-2|DJ886K2.4
Gene description: lysophospholipase II
Genbank accession: NM_007260
Immunogen: LYPLA2 (NP_009191, 144 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Protein accession: NP_009191
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011313-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011313-M01-13-15-1.jpg
Application image note: Western Blot analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 monoclonal antibody (M01), clone 3H5.

Lane 1: LYPLA2 transfected lysate (Predicted MW: 24.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LYPLA2 monoclonal antibody (M01), clone 3H5 now

Add to cart