Brand: | Abnova |
Reference: | H00011281-M05 |
Product name: | POU6F2 monoclonal antibody (M05), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU6F2. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 11281 |
Gene name: | POU6F2 |
Gene alias: | RPF-1|WT5|WTSL |
Gene description: | POU class 6 homeobox 2 |
Genbank accession: | NM_007252 |
Immunogen: | POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP |
Protein accession: | NP_009183 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |