SCN11A monoclonal antibody (M04), clone 6E1 View larger

SCN11A monoclonal antibody (M04), clone 6E1

H00011280-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCN11A monoclonal antibody (M04), clone 6E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCN11A monoclonal antibody (M04), clone 6E1

Brand: Abnova
Reference: H00011280-M04
Product name: SCN11A monoclonal antibody (M04), clone 6E1
Product description: Mouse monoclonal antibody raised against a partial recombinant SCN11A.
Clone: 6E1
Isotype: IgG2a Kappa
Gene id: 11280
Gene name: SCN11A
Gene alias: NAV1.9|NaN|SCN12A|SNS-2
Gene description: sodium channel, voltage-gated, type XI, alpha subunit
Genbank accession: NM_014139
Immunogen: SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
Protein accession: NP_054858
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011280-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011280-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SCN11A is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCN11A monoclonal antibody (M04), clone 6E1 now

Add to cart