KLF8 monoclonal antibody (M12), clone 3F10 View larger

KLF8 monoclonal antibody (M12), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLF8 monoclonal antibody (M12), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about KLF8 monoclonal antibody (M12), clone 3F10

Brand: Abnova
Reference: H00011279-M12
Product name: KLF8 monoclonal antibody (M12), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant KLF8.
Clone: 3F10
Isotype: IgG2a Kappa
Gene id: 11279
Gene name: KLF8
Gene alias: BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene description: Kruppel-like factor 8
Genbank accession: NM_007250
Immunogen: KLF8 (NP_009181.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL
Protein accession: NP_009181.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011279-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011279-M12-13-15-1.jpg
Application image note: Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody (M12), clone 3F10.

Lane 1: KLF8 transfected lysate(39.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLF8 monoclonal antibody (M12), clone 3F10 now

Add to cart