Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011279-M12 |
Product name: | KLF8 monoclonal antibody (M12), clone 3F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF8. |
Clone: | 3F10 |
Isotype: | IgG2a Kappa |
Gene id: | 11279 |
Gene name: | KLF8 |
Gene alias: | BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741 |
Gene description: | Kruppel-like factor 8 |
Genbank accession: | NM_007250 |
Immunogen: | KLF8 (NP_009181.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL |
Protein accession: | NP_009181.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody (M12), clone 3F10. Lane 1: KLF8 transfected lysate(39.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |