PRR4 monoclonal antibody (M02), clone 1D2 View larger

PRR4 monoclonal antibody (M02), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRR4 monoclonal antibody (M02), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PRR4 monoclonal antibody (M02), clone 1D2

Brand: Abnova
Reference: H00011272-M02
Product name: PRR4 monoclonal antibody (M02), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant PRR4.
Clone: 1D2
Isotype: IgG2a Kappa
Gene id: 11272
Gene name: PRR4
Gene alias: DKFZp779L1763|LPRP|PROL4
Gene description: proline rich 4 (lacrimal)
Genbank accession: NM_007244
Immunogen: PRR4 (NP_009175.1, 17 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEAS
Protein accession: NP_009175.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011272-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011272-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PRR4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRR4 monoclonal antibody (M02), clone 1D2 now

Add to cart