SNF8 monoclonal antibody (M01), clone 6B11 View larger

SNF8 monoclonal antibody (M01), clone 6B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNF8 monoclonal antibody (M01), clone 6B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SNF8 monoclonal antibody (M01), clone 6B11

Brand: Abnova
Reference: H00011267-M01
Product name: SNF8 monoclonal antibody (M01), clone 6B11
Product description: Mouse monoclonal antibody raised against a partial recombinant SNF8.
Clone: 6B11
Isotype: IgG1 Kappa
Gene id: 11267
Gene name: SNF8
Gene alias: Dot3|EAP30|VPS22
Gene description: SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
Genbank accession: NM_007241
Immunogen: SNF8 (NP_009172, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE
Protein accession: NP_009172
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011267-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011267-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SNF8 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNF8 monoclonal antibody (M01), clone 6B11 now

Add to cart